![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
![]() | Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families) ![]() |
![]() | Family d.41.3.0: automated matches [254277] (1 protein) not a true family |
![]() | Protein automated matches [254643] (6 species) not a true protein |
![]() | Species Salmonella enterica [TaxId:90371] [311686] (2 PDB entries) |
![]() | Domain d4xr5a3: 4xr5 A:336-440 [311894] Other proteins in same PDB: d4xr5a1, d4xr5a2, d4xr5b1, d4xr5b2 automated match to d4x46b3 complexed with cl, peg, pge |
PDB Entry: 4xr5 (more details), 2.05 Å
SCOPe Domain Sequences for d4xr5a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xr5a3 d.41.3.0 (A:336-440) automated matches {Salmonella enterica [TaxId: 90371]} tamlskavyadtegfisamdtralgmavvsmgggrrqasdtidysvgftdmarlgdsidg qrplavihakdeaswqeaakavkaaiilddkapastpsvyrrite
Timeline for d4xr5a3: