Lineage for d1d04a_ (1d04 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120208Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 120383Superfamily c.23.5: Flavoproteins [52218] (3 families) (S)
  5. 120384Family c.23.5.1: Flavodoxin-related [52219] (3 proteins)
  6. 120385Protein Flavodoxin [52220] (7 species)
  7. 120395Species Anacystis nidulans and Synechococcus, pcc 7942 [52225] (10 PDB entries)
  8. 120401Domain d1d04a_: 1d04 A: [31189]

Details for d1d04a_

PDB Entry: 1d04 (more details), 1.85 Å

PDB Description: comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.

SCOP Domain Sequences for d1d04a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d04a_ c.23.5.1 (A:) Flavodoxin {Anacystis nidulans and Synechococcus, pcc 7942}
akiglfygtqtgvtqtiaesiqqefggesivdlndianadasdlnaydyliigcptwnvg
elqsdwegiyddldsvnfqgkkvayfgagdqvgysdnfqdamgileekisslgsqtvgyw
piegydfneskavrnnqfvglaidednqpdltknriktwvsqlksefgl

SCOP Domain Coordinates for d1d04a_:

Click to download the PDB-style file with coordinates for d1d04a_.
(The format of our PDB-style files is described here.)

Timeline for d1d04a_: