SCOPe 2.06: Domain d4y9ra3: 4y9r A:519-678

Lineage for d4y9ra3 (4y9r A:519-678)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.0: automated matches [227163] (1 protein)
   not a true family

6. Protein automated matches [226871] (18 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [256001] (10 PDB entries)

8. Domain d4y9ra3: 4y9r A:519-678 [311886]
   Other proteins in same PDB: d4y9ra1, d4y9ra2, d4y9rb1, d4y9rb2
   automated match to d1j9za3
   complexed with fad, fmn, nap, po4; mutant

Details for d4y9ra3

PDB Entry: 4y9r, 2.4 Å

PDB Description: rat cypor mutant - g141del

PDB Compounds: (A:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d4y9ra3:

Sequence; same for both SEQRES and ATOM records:

>d4y9ra3 c.25.1.0 (A:519-678) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rlpfksttpvimvgpgtgiapfmgfiqerawlreqgkevgetllyygcrrsdedylyree
larfhkdgaltqlnvafsreqahkvyvqhllkrdrehlwkliheggahiyvcgdarnmak
dvqntfydivaefgpmehtqavdyvkklmtkgrysldvws

Timeline for d4y9ra3:

• d4y9ra3 is new in SCOPe 2.06-stable
  
• d4y9ra3 appears in SCOPe 2.07
  
• d4y9ra3 appears in the current release, SCOPe 2.08