Lineage for d4xceb1 (4xce B:1-106)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347244Species Human (Homo sapiens) [TaxId:9606] [188740] (192 PDB entries)
  8. 2347602Domain d4xceb1: 4xce B:1-106 [311875]
    Other proteins in same PDB: d4xceb2, d4xced2, d4xcel2
    automated match to d1dn0a1

Details for d4xceb1

PDB Entry: 4xce (more details), 2.93 Å

PDB Description: crystal structure of human 4e10 fab crystalized in the presence of phosphatidylcholine (06:0 pc); c2 space group
PDB Compounds: (B:) 4E10 Fab light chain

SCOPe Domain Sequences for d4xceb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xceb1 b.1.1.1 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvev

SCOPe Domain Coordinates for d4xceb1:

Click to download the PDB-style file with coordinates for d4xceb1.
(The format of our PDB-style files is described here.)

Timeline for d4xceb1: