Lineage for d4ww2a2 (4ww2 A:128-216)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (16 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (983 PDB entries)
  8. 2353332Domain d4ww2a2: 4ww2 A:128-216 [311874]
    Other proteins in same PDB: d4ww2a1, d4ww2b1, d4ww2b2, d4ww2c1, d4ww2c2, d4ww2f_
    automated match to d2pyfa2
    complexed with jls, nag

Details for d4ww2a2

PDB Entry: 4ww2 (more details), 2.48 Å

PDB Description: crystal structure of human tcr alpha chain-trav21-traj8, beta chain- trbv7-8, antigen-presenting glycoprotein cd1d, and beta-2- microglobulin
PDB Compounds: (A:) TCR Alpha Chain-TRAV21-TRAJ8

SCOPe Domain Sequences for d4ww2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ww2a2 b.1.1.2 (A:128-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d4ww2a2:

Click to download the PDB-style file with coordinates for d4ww2a2.
(The format of our PDB-style files is described here.)

Timeline for d4ww2a2: