SCOPe 2.08: Domain d4ww2a2: 4ww2 A:128-216

Lineage for d4ww2a2 (4ww2 A:128-216)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4ww2a2: 4ww2 A:128-216 [311874]
   Other proteins in same PDB: d4ww2a1, d4ww2b1, d4ww2b2, d4ww2c1, d4ww2c2, d4ww2f_
   automated match to d2pyfa2
   complexed with jls, nag

Details for d4ww2a2

PDB Entry: 4ww2, 2.48 Å

PDB Description: crystal structure of human tcr alpha chain-trav21-traj8, beta chain- trbv7-8, antigen-presenting glycoprotein cd1d, and beta-2- microglobulin

PDB Compounds: (A:) TCR Alpha Chain-TRAV21-TRAJ8

SCOPe Domain Sequences for d4ww2a2:

Sequence; same for both SEQRES and ATOM records:

>d4ww2a2 b.1.1.2 (A:128-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Timeline for d4ww2a2:

• d4ww2a2 first appeared in SCOPe 2.06
  
• d4ww2a2 appears in SCOPe 2.07