Lineage for d4ww2a1 (4ww2 A:0-127)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033748Domain d4ww2a1: 4ww2 A:0-127 [311873]
    Other proteins in same PDB: d4ww2a2, d4ww2c1, d4ww2f_
    automated match to d2pyfa1
    complexed with jls, nag

Details for d4ww2a1

PDB Entry: 4ww2 (more details), 2.48 Å

PDB Description: crystal structure of human tcr alpha chain-trav21-traj8, beta chain- trbv7-8, antigen-presenting glycoprotein cd1d, and beta-2- microglobulin
PDB Compounds: (A:) TCR Alpha Chain-TRAV21-TRAJ8

SCOPe Domain Sequences for d4ww2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ww2a1 b.1.1.0 (A:0-127) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkqevtqipaalsvpegenlvlncsftdsaiynlqwfrqdpgkgltsllliqssqreqts
grlnasldkssgrstlyiaasqpgdsatylcagvntgfqklvfgtgtrllvspn

SCOPe Domain Coordinates for d4ww2a1:

Click to download the PDB-style file with coordinates for d4ww2a1.
(The format of our PDB-style files is described here.)

Timeline for d4ww2a1: