SCOPe 2.02: Domain d1czra_: 1czr A:

Lineage for d1czra_ (1czr A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
   binds FMN

6. Protein Flavodoxin [52220] (9 species)

7. Species Synechococcus elongatus PCC 7942 [TaxId:1140] [52225] (10 PDB entries)

8. Domain d1czra_: 1czr A: [31187]
   complexed with fmn; mutant

Details for d1czra_

PDB Entry: 1czr, 1.9 Å

PDB Description: comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.

PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d1czra_:

Sequence; same for both SEQRES and ATOM records:

>d1czra_ c.23.5.1 (A:) Flavodoxin {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
akiglfygtqtgvtqtiaesiqqefggesivdlndianadasdlnaydyliigcptwnvg
elqsdwegiyddldsvnfqgkkvayfgagnqvgysdnfqdamgileekisslgsqtvgyw
piegydfneskavrnnqfvglaidednqpdltknriktwvsqlksefgl

Timeline for d1czra_:

• d1czra_ first appeared (with stable ids) in SCOP 1.55
  
• d1czra_ appears in SCOPe 2.01
  
• d1czra_ appears in SCOPe 2.03
  
• d1czra_ appears in the current release, SCOPe 2.08