SCOPe 2.07: Domain d4xced1: 4xce D:1-106

Lineage for d4xced1 (4xce D:1-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)

8. Domain d4xced1: 4xce D:1-106 [311860]
   Other proteins in same PDB: d4xceb2, d4xced2, d4xcel2
   automated match to d1dn0a1

Details for d4xced1

PDB Entry: 4xce, 2.93 Å

PDB Description: crystal structure of human 4e10 fab crystalized in the presence of phosphatidylcholine (06:0 pc); c2 space group

PDB Compounds: (D:) 4E10 Fab light chain

SCOPe Domain Sequences for d4xced1:

Sequence; same for both SEQRES and ATOM records:

>d4xced1 b.1.1.1 (D:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvev

Timeline for d4xced1:

• d4xced1 first appeared in SCOPe 2.06
  
• d4xced1 appears in the current release, SCOPe 2.08