Lineage for d1czka_ (1czk A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2464623Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2464624Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 2464625Protein Flavodoxin [52220] (10 species)
  7. 2464700Species Synechococcus elongatus PCC 7942 [TaxId:1140] [52225] (10 PDB entries)
  8. 2464707Domain d1czka_: 1czk A: [31186]
    complexed with fmn; mutant

Details for d1czka_

PDB Entry: 1czk (more details), 1.9 Å

PDB Description: comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d1czka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1czka_ c.23.5.1 (A:) Flavodoxin {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
akiglfygtqtgvtqtiaesiqqefggesivdlndianadasdlnaydyliigcptwnvg
elqsdwegiyddldsvnfqgkkvayfgagdqvgysdnfqnamgileekisslgsqtvgyw
piegydfneskavrnnqfvglaidednqpdltknriktwvsqlksefgl

SCOPe Domain Coordinates for d1czka_:

Click to download the PDB-style file with coordinates for d1czka_.
(The format of our PDB-style files is described here.)

Timeline for d1czka_: