Structural Classification of Proteins and ASTRAL release 1.75 (June 2009)
Search SCOP (example):

Lineage for d1czka_ (1czk A:)

  1. Root: SCOP 1.75
  2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. Family c.23.5.1: Flavodoxin-related [52219] (5 protein domains)
    binds FMN
  6. Protein Flavodoxin [52220] (9 species)
  7. Species Synechococcus elongatus PCC 7942 [TaxId:1140] [52225] (10 PDB entries)
  8. Domain d1czka_: 1czk A: [31186]

Details for d1czka_

PDB Entry: 1czk (more details)
PDB Description: comparisons of wild type and mutant flavodoxins from anacyst nidulans. structural determinants of the redox potentials.
PDB Compounds: (A:) flavodoxin

SCOP Domain Sequences for d1czka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1czka_ c.23.5.1 (A:) Flavodoxin {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
akiglfygtqtgvtqtiaesiqqefggesivdlndianadasdlnaydyliigcptwnvg
elqsdwegiyddldsvnfqgkkvayfgagdqvgysdnfqnamgileekisslgsqtvgyw
piegydfneskavrnnqfvglaidednqpdltknriktwvsqlksefgl

SCOP Domain Coordinates for d1czka_:

Click to download the PDB-style file with coordinates for d1czka_.
(The format of our PDB-style files is described here.)

Timeline for d1czka_:

d1czka_ appears in SCOP 1.73
d1czka_ appears in SCOP 1.75A


d1czka_
(click for larger image)


d1czka_ in context of chain

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu