| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (8 families) ![]() |
| Family c.23.5.1: Flavodoxin-related [52219] (5 protein domains) binds FMN |
| Protein Flavodoxin [52220] (9 species) |
| Species Synechococcus elongatus PCC 7942 [TaxId:1140] [52225] (10 PDB entries) |
| Domain d1czka_: 1czk A: [31186] |
| PDB Entry: 1czk (more details) PDB Description: comparisons of wild type and mutant flavodoxins from anacyst nidulans. structural determinants of the redox potentials.
PDB Compounds: (A:) flavodoxinSCOP Domain Sequences for d1czka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1czka_ c.23.5.1 (A:) Flavodoxin {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
akiglfygtqtgvtqtiaesiqqefggesivdlndianadasdlnaydyliigcptwnvg
elqsdwegiyddldsvnfqgkkvayfgagdqvgysdnfqnamgileekisslgsqtvgyw
piegydfneskavrnnqfvglaidednqpdltknriktwvsqlksefgl
SCOP Domain Coordinates for d1czka_:
Click to download the PDB-style file with coordinates for d1czka_. (The format of our PDB-style files is described here.)
Timeline for d1czka_:
d1czka_ appears in SCOP 1.73 | d1czka_ (click for larger image) d1czka_ in context of chain |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |