SCOPe 2.06: Domain d4xoea2: 4xoe A:159-279

Lineage for d4xoea2 (4xoe A:159-279)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (10 proteins)

6. Protein automated matches [190569] (10 species)
   not a true protein

7. Species Escherichia coli [TaxId:362663] [311670] (2 PDB entries)

8. Domain d4xoea2: 4xoe A:159-279 [311855]
   automated match to d1klfb2
   complexed with cac, kgm

Details for d4xoea2

PDB Entry: 4xoe, 2.4 Å

PDB Description: crystal structure of a fimh*dsg complex from e.coli f18 with bound heptyl alpha-d-mannopyrannoside

PDB Compounds: (A:) FimH PROTEIN

SCOPe Domain Sequences for d4xoea2:

Sequence; same for both SEQRES and ATOM records:

>d4xoea2 b.2.3.2 (A:159-279) automated matches {Escherichia coli [TaxId: 362663]}
ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q

Timeline for d4xoea2:

• d4xoea2 is new in SCOPe 2.06-stable
  
• d4xoea2 appears in SCOPe 2.07
  
• d4xoea2 appears in the current release, SCOPe 2.08