Lineage for d1czha_ (1czh A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68133Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 68298Superfamily c.23.5: Flavoproteins [52218] (3 families) (S)
  5. 68299Family c.23.5.1: Flavodoxin-related [52219] (3 proteins)
  6. 68300Protein Flavodoxin [52220] (6 species)
  7. 68310Species Anacystis nidulans and Synechococcus, pcc 7942 [52225] (10 PDB entries)
  8. 68315Domain d1czha_: 1czh A: [31185]

Details for d1czha_

PDB Entry: 1czh (more details), 1.86 Å

PDB Description: comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.

SCOP Domain Sequences for d1czha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1czha_ c.23.5.1 (A:) Flavodoxin {Anacystis nidulans and Synechococcus, pcc 7942}
akiglfygtqtgvtqtiaesiqqefggesivdlndianadasdlnaydyliigcptwgvg
elqsdwegiyddldsvnfqgkkvayfgagdqvgysdnfqdamgileekisslgsqtvgyw
piegydfneskavrnnqfvglaidednqpdltknriktwvsqlksefgl

SCOP Domain Coordinates for d1czha_:

Click to download the PDB-style file with coordinates for d1czha_.
(The format of our PDB-style files is described here.)

Timeline for d1czha_: