| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
| Protein Alkyl hydroperoxide reductase AhpC [69516] (5 species) |
| Species Salmonella enterica [TaxId:90371] [229124] (7 PDB entries) |
| Domain d4xrdc_: 4xrd C: [311848] automated match to d4ma9b_ complexed with cl, k, so4; mutant |
PDB Entry: 4xrd (more details), 2.3 Å
SCOPe Domain Sequences for d4xrdc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xrdc_ c.47.1.10 (C:) Alkyl hydroperoxide reductase AhpC {Salmonella enterica [TaxId: 90371]}
slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpakfke
Timeline for d4xrdc_:
View in 3DDomains from other chains: (mouse over for more information) d4xrda_, d4xrdb_, d4xrdd_, d4xrde_ |