SCOPe 2.08: Domain d4y26a_: 4y26 A:

Lineage for d4y26a_ (4y26 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (109 PDB entries)

8. Domain d4y26a_: 4y26 A: [311840]
   automated match to d2zhna_

Details for d4y26a_

PDB Entry: 4y26, 2.61 Å

PDB Description: complex of human galectin-7 and galbeta1-3(6oso3)glcnac

PDB Compounds: (A:) galectin-7

SCOPe Domain Sequences for d4y26a_:

Sequence; same for both SEQRES and ATOM records:

>d4y26a_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevvfn
skeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrlve
vggdvqldsvrif

Timeline for d4y26a_:

• d4y26a_ first appeared in SCOPe 2.06
  
• d4y26a_ appears in SCOPe 2.07