SCOPe 2.07: Domain d4xo7b_: 4xo7 B:

Lineage for d4xo7b_ (4xo7 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein 3-alpha-hydroxysteroid dehydrogenase [51439] (2 species)

7. Species Human (Homo sapiens), type III [TaxId:9606] [69383] (16 PDB entries)
   bile acid binding protein

8. Domain d4xo7b_: 4xo7 B: [311829]
   automated match to d1ihia_
   complexed with asd, nap, so4

Details for d4xo7b_

PDB Entry: 4xo7, 1.75 Å

PDB Description: crystal structure of human 3-alpha hydroxysteroid dehydrogenase type 3 in complex with nadp+, 5alpha-androstan-3,17-dione and (3beta, 5alpha)-3-hydroxyandrostan-17-one

PDB Compounds: (B:) Aldo-keto reductase family 1 member C2

SCOPe Domain Sequences for d4xo7b_:

Sequence; same for both SEQRES and ATOM records:

>d4xo7b_ c.1.7.1 (B:) 3-alpha-hydroxysteroid dehydrogenase {Human (Homo sapiens), type III [TaxId: 9606]}
dskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeqv
glairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpvs
vkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkpg
lkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvl
calakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnr
nvryltldifagppnypfsdey

Timeline for d4xo7b_:

• d4xo7b_ first appeared in SCOPe 2.06
  
• d4xo7b_ appears in the current release, SCOPe 2.08