![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
![]() | Superfamily a.128.1: Terpenoid synthases [48576] (6 families) ![]() duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
![]() | Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins) |
![]() | Protein automated matches [190489] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187688] (85 PDB entries) |
![]() | Domain d4xqtf_: 4xqt F: [311827] automated match to d4demf_ complexed with mg, so4 |
PDB Entry: 4xqt (more details), 2.1 Å
SCOPe Domain Sequences for d4xqtf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xqtf_ a.128.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvvvafre lveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgldain danlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvrfte kryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyldlfg dpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyeeldl pavflqyeedsyshimalieqyaaplppavflglarkiy
Timeline for d4xqtf_: