Lineage for d2n06a_ (2n06 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712363Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 2712364Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 2712548Family a.42.1.0: automated matches [191556] (1 protein)
    not a true family
  6. 2712549Protein automated matches [190960] (1 species)
    not a true protein
  7. 2712550Species Human (Homo sapiens) [TaxId:9606] [188578] (22 PDB entries)
  8. 2712588Domain d2n06a_: 2n06 A: [311826]
    automated match to d3jzqb_
    complexed with 44z

Details for d2n06a_

PDB Entry: 2n06 (more details)

PDB Description: mdmx-298
PDB Compounds: (A:) Protein Mdm4

SCOPe Domain Sequences for d2n06a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n06a_ a.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllg
ellgrqsfsvkdpsplydmlrknlvtlat

SCOPe Domain Coordinates for d2n06a_:

Click to download the PDB-style file with coordinates for d2n06a_.
(The format of our PDB-style files is described here.)

Timeline for d2n06a_: