SCOPe 2.06: Domain d4xoae2: 4xoa E:159-279

Lineage for d4xoae2 (4xoa E:159-279)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (10 proteins)

6. Protein Mannose-specific adhesin FimH [49406] (2 species)
   duplication: consists of two domains of this fold; C-terminal domain lacks the last strand

7. Species Escherichia coli [TaxId:83333] [273015] (7 PDB entries)

8. Domain d4xoae2: 4xoa E:159-279 [311810]
   automated match to d1klfb2

Details for d4xoae2

PDB Entry: 4xoa, 2.54 Å

PDB Description: crystal structure of a fimh*dsg complex from e.coli k12 in space group p1

PDB Compounds: (E:) protein fimh

SCOPe Domain Sequences for d4xoae2:

Sequence; same for both SEQRES and ATOM records:

>d4xoae2 b.2.3.2 (E:159-279) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 83333]}
ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q

Timeline for d4xoae2:

• d4xoae2 is new in SCOPe 2.06-stable
  
• d4xoae2 appears in SCOPe 2.07
  
• d4xoae2 appears in the current release, SCOPe 2.08