![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
![]() | Family b.2.3.2: Pilus subunits [49405] (11 proteins) |
![]() | Protein Mannose-specific adhesin FimH, C-terminal domain [418901] (2 species) protein duplication: consists of two domains of this fold; C-terminal domain lacks the last strand |
![]() | Species Escherichia coli [TaxId:83333] [419303] (2 PDB entries) |
![]() | Domain d4xoae2: 4xoa E:159-279 [311810] Other proteins in same PDB: d4xoaa1, d4xoac1, d4xoae1, d4xoag1 automated match to d1klfb2 missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 4xoa (more details), 2.54 Å
SCOPe Domain Sequences for d4xoae2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xoae2 b.2.3.2 (E:159-279) Mannose-specific adhesin FimH, C-terminal domain {Escherichia coli [TaxId: 83333]} ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy q
Timeline for d4xoae2: