Lineage for d1czna_ (1czn A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 982673Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 982674Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 982675Protein Flavodoxin [52220] (9 species)
  7. 982748Species Synechococcus elongatus PCC 7942 [TaxId:1140] [52225] (10 PDB entries)
  8. 982749Domain d1czna_: 1czn A: [31181]
    complexed with fmn

Details for d1czna_

PDB Entry: 1czn (more details), 1.7 Å

PDB Description: refined structures of oxidized flavodoxin from anacystis nidulans
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d1czna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1czna_ c.23.5.1 (A:) Flavodoxin {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
akiglfygtqtgvtqtiaesiqqefggesivdlndianadasdlnaydyliigcptwnvg
elqsdwegiyddldsvnfqgkkvayfgagdqvgysdnfqdamgileekisslgsqtvgyw
piegydfneskavrnnqfvglaidednqpdltknriktwvsqlksefgl

SCOPe Domain Coordinates for d1czna_:

Click to download the PDB-style file with coordinates for d1czna_.
(The format of our PDB-style files is described here.)

Timeline for d1czna_: