Lineage for d1czna_ (1czn A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120208Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 120383Superfamily c.23.5: Flavoproteins [52218] (3 families) (S)
  5. 120384Family c.23.5.1: Flavodoxin-related [52219] (3 proteins)
  6. 120385Protein Flavodoxin [52220] (7 species)
  7. 120395Species Anacystis nidulans and Synechococcus, pcc 7942 [52225] (10 PDB entries)
  8. 120396Domain d1czna_: 1czn A: [31181]

Details for d1czna_

PDB Entry: 1czn (more details), 1.7 Å

PDB Description: refined structures of oxidized flavodoxin from anacystis nidulans

SCOP Domain Sequences for d1czna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1czna_ c.23.5.1 (A:) Flavodoxin {Anacystis nidulans and Synechococcus, pcc 7942}
akiglfygtqtgvtqtiaesiqqefggesivdlndianadasdlnaydyliigcptwnvg
elqsdwegiyddldsvnfqgkkvayfgagdqvgysdnfqdamgileekisslgsqtvgyw
piegydfneskavrnnqfvglaidednqpdltknriktwvsqlksefgl

SCOP Domain Coordinates for d1czna_:

Click to download the PDB-style file with coordinates for d1czna_.
(The format of our PDB-style files is described here.)

Timeline for d1czna_: