Lineage for d4xoae1 (4xoa E:1-158)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767443Family b.2.3.2: Pilus subunits [49405] (11 proteins)
  6. 2767497Protein Mannose-specific adhesin FimH, N-terminal domain [418900] (2 species)
    protein duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 2767561Species Escherichia coli [TaxId:83333] [419302] (26 PDB entries)
  8. 2767630Domain d4xoae1: 4xoa E:1-158 [311809]
    Other proteins in same PDB: d4xoaa2, d4xoac2, d4xoae2, d4xoag2
    automated match to d1klfb1

Details for d4xoae1

PDB Entry: 4xoa (more details), 2.54 Å

PDB Description: crystal structure of a fimh*dsg complex from e.coli k12 in space group p1
PDB Compounds: (E:) protein fimh

SCOPe Domain Sequences for d4xoae1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xoae1 b.2.3.2 (E:1-158) Mannose-specific adhesin FimH, N-terminal domain {Escherichia coli [TaxId: 83333]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d4xoae1:

Click to download the PDB-style file with coordinates for d4xoae1.
(The format of our PDB-style files is described here.)

Timeline for d4xoae1: