Lineage for d1ahn__ (1ahn -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.23: Flavodoxin-like [52171] (17 superfamilies) 
Superfamily c.23.5: Flavoproteins [52218] (3 families) 
Family c.23.5.1: Flavodoxin-related [52219] (3 proteins) Protein Flavodoxin [52220] (6 species) 
Species Escherichia coli [TaxId:562] [52224] (2 PDB entries) 
Domain d1ahn__: 1ahn - [31180]
Details for d1ahn__
PDB Entry: 1ahn (more details), 2.6 Å
PDB Description: e. coli flavodoxin at 2.6 angstroms resolution
SCOP Domain Sequences for d1ahn__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ahn__ c.23.5.1 (-) Flavodoxin {Escherichia coli}
aitgiffgsdtgnteniakmiqkqlgkdvadvhdiaksskedleaydilllgiptwyyge
aqcdwddffptleeidfngklvalfgcgdqedyaeyfcdalgtirdiieprgativghwp
tagyhfeaskgladddhfvglaidedrqpeltaervekwvkqiseelhl
SCOP Domain Coordinates for d1ahn__:
Click to download the PDB-style file with coordinates for d1ahn__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ahn__:
- d1ahn__ first appeared (with stable ids) in SCOP 1.55
- d1ahn__ appears in SCOP 1.59
- d1ahn__ appears in the current release, SCOPe 2.08, called d1ahna_
View in 3D