![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
![]() | Family c.23.5.1: Flavodoxin-related [52219] (6 proteins) binds FMN |
![]() | Protein Flavodoxin [52220] (11 species) |
![]() | Species Escherichia coli [TaxId:562] [52224] (2 PDB entries) |
![]() | Domain d1ahna_: 1ahn A: [31180] complexed with ca, fmn |
PDB Entry: 1ahn (more details), 2.6 Å
SCOPe Domain Sequences for d1ahna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ahna_ c.23.5.1 (A:) Flavodoxin {Escherichia coli [TaxId: 562]} aitgiffgsdtgnteniakmiqkqlgkdvadvhdiaksskedleaydilllgiptwyyge aqcdwddffptleeidfngklvalfgcgdqedyaeyfcdalgtirdiieprgativghwp tagyhfeaskgladddhfvglaidedrqpeltaervekwvkqiseelhl
Timeline for d1ahna_: