Lineage for d4xxaa_ (4xxa A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051795Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2051796Protein automated matches [190437] (53 species)
    not a true protein
  7. 2052398Species Vatairea macrocarpa [TaxId:77050] [268912] (6 PDB entries)
  8. 2052405Domain d4xxaa_: 4xxa A: [311792]
    Other proteins in same PDB: d4xxab2
    automated match to d4u36a_
    complexed with 1pe, ca, gol, mn

Details for d4xxaa_

PDB Entry: 4xxa (more details), 1.9 Å

PDB Description: crystal structure of a recombinant vatairea macrocarpa seed lectin
PDB Compounds: (A:) seed lectin

SCOPe Domain Sequences for d4xxaa_:

Sequence, based on SEQRES records: (download)

>d4xxaa_ b.29.1.0 (A:) automated matches {Vatairea macrocarpa [TaxId: 77050]}
sevvsfsftkfnpnpkdiilqgdalvtskgklqltkvkdgkpvdhslgralyaapihiwd
dstdrvasfatsfsfvveapdesktadgiafflappdtqpqkdggflglfndsnksiqtv
avefdtfsntwdpsarhiginvnsiesmkyvkwgwengkvanvyisyeastktltaslty
psnatsyivsanvdlksalpewvrvgfsatsglsrdhvethdvldwsftstlqap

Sequence, based on observed residues (ATOM records): (download)

>d4xxaa_ b.29.1.0 (A:) automated matches {Vatairea macrocarpa [TaxId: 77050]}
sevvsfsftkfnpnpkdiilqgdalvtskgklqltkvkdgkpvdhslgralyaapihiwd
dstdrvasfatsfsfvveapdesktadgiafflappdtqpqkdggflglfndnksiqtva
vefdtfsntwdpsarhiginvnsiesmkyvkwgwengkvanvyisyeastktltasltyp
snatsyivsanvdlksalpewvrvgfsatsglsrdhvethdvldwsftstlqap

SCOPe Domain Coordinates for d4xxaa_:

Click to download the PDB-style file with coordinates for d4xxaa_.
(The format of our PDB-style files is described here.)

Timeline for d4xxaa_: