Structural Classification of Proteins and ASTRAL release 1.75 (June 2009)
Search SCOP (example):

Lineage for d1ag9b_ (1ag9 B:)

  1. Root: SCOP 1.75
  2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. Family c.23.5.1: Flavodoxin-related [52219] (5 protein domains)
    binds FMN
  6. Protein Flavodoxin [52220] (9 species)
  7. Species Escherichia coli [TaxId:562] [52224] (2 PDB entries)
  8. Domain d1ag9b_: 1ag9 B: [31179]
    complexed with btb, ca, cl, fmn, na

Details for d1ag9b_

PDB Entry: 1ag9 (more details)
PDB Description: flavodoxins that are required for enzyme activation: the structure of oxidized flavodoxin from escherichia coli at 1.8 angstroms resolution.
PDB Compounds: (B:) flavodoxin

SCOP Domain Sequences for d1ag9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ag9b_ c.23.5.1 (B:) Flavodoxin {Escherichia coli [TaxId: 562]}
aitgiffgsdtgnteniakmiqkqlgkdvadvhdiaksskedleaydilllgiptwyyge
aqcdwddffptleeidfngklvalfgcgdqedyaeyfcdalgtirdiieprgativghwp
tagyhfeaskgladddhfvglaidedrqpeltaervekwvkqiseelhldeilna

SCOP Domain Coordinates for d1ag9b_:

Click to download the PDB-style file with coordinates for d1ag9b_.
(The format of our PDB-style files is described here.)

Timeline for d1ag9b_:

d1ag9b_ appears in SCOP 1.73
d1ag9b_ appears in SCOP 1.75A


d1ag9b_
(click for larger image)


d1ag9b_ in context of chain



d1ag9b_ in context of PDB
Domains from other chains:
d1ag9a_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu