SCOPe 2.08: Domain d4y1xb_: 4y1x B:

Lineage for d4y1xb_ (4y1x B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-1 [100925] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101638] (33 PDB entries)
   Uniprot P09382

8. Domain d4y1xb_: 4y1x B: [311785]
   automated match to d4q27b_

Details for d4y1xb_

PDB Entry: 4y1x, 2.45 Å

PDB Description: complex of human galectin-1 and galbeta1-4(6oso3)glcnac

PDB Compounds: (B:) galectin-1

SCOPe Domain Sequences for d4y1xb_:

Sequence; same for both SEQRES and ATOM records:

>d4y1xb_ b.29.1.3 (B:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}
cglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivcn
skdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainyma
adgdfkikcvafd

Timeline for d4y1xb_:

• d4y1xb_ first appeared in SCOPe 2.06
  
• d4y1xb_ appears in SCOPe 2.07