Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) |
Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
Protein automated matches [190896] (11 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [311778] (2 PDB entries) |
Domain d2myfa1: 2myf A:1-86 [311779] Other proteins in same PDB: d2myfa2 automated match to d2km8b_ |
PDB Entry: 2myf (more details)
SCOPe Domain Sequences for d2myfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2myfa1 d.58.7.0 (A:1-86) automated matches {Plasmodium falciparum [TaxId: 36329]} msdnnatdilfvggidetidekslydifssfgdirnievplnmttkknrgfafveyvevd dakhalynmnnfelngkrihvnyskt
Timeline for d2myfa1: