Lineage for d2myfa1 (2myf A:1-86)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952471Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2952472Protein automated matches [190896] (11 species)
    not a true protein
  7. 2952699Species Plasmodium falciparum [TaxId:36329] [311778] (2 PDB entries)
  8. 2952701Domain d2myfa1: 2myf A:1-86 [311779]
    Other proteins in same PDB: d2myfa2
    automated match to d2km8b_

Details for d2myfa1

PDB Entry: 2myf (more details)

PDB Description: solution structure of rna recognition motif of a cyclophilin33-like protein from plasmodium falciparum
PDB Compounds: (A:) RRM containing cyclophilin

SCOPe Domain Sequences for d2myfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2myfa1 d.58.7.0 (A:1-86) automated matches {Plasmodium falciparum [TaxId: 36329]}
msdnnatdilfvggidetidekslydifssfgdirnievplnmttkknrgfafveyvevd
dakhalynmnnfelngkrihvnyskt

SCOPe Domain Coordinates for d2myfa1:

Click to download the PDB-style file with coordinates for d2myfa1.
(The format of our PDB-style files is described here.)

Timeline for d2myfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2myfa2