Lineage for d2n0wa_ (2n0w A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998383Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 1998384Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 1998547Family a.42.1.0: automated matches [191556] (1 protein)
    not a true family
  6. 1998548Protein automated matches [190960] (1 species)
    not a true protein
  7. 1998549Species Human (Homo sapiens) [TaxId:9606] [188578] (14 PDB entries)
  8. 1998573Domain d2n0wa_: 2n0w A: [311775]
    automated match to d3jzqb_
    complexed with 48l

Details for d2n0wa_

PDB Entry: 2n0w (more details)

PDB Description: mdmx-sj212
PDB Compounds: (A:) Protein Mdm4

SCOPe Domain Sequences for d2n0wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n0wa_ a.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllg
ellgrqsfsvkdpsplydmlrknlvtlat

SCOPe Domain Coordinates for d2n0wa_:

Click to download the PDB-style file with coordinates for d2n0wa_.
(The format of our PDB-style files is described here.)

Timeline for d2n0wa_: