SCOPe 2.06: Domain d4x9xa_: 4x9x A:

Lineage for d4x9xa_ (4x9x A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
   2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]

4. Superfamily c.119.1: DAK1/DegV-like [82549] (3 families)
   domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different

5. Family c.119.1.0: automated matches [191443] (1 protein)
   not a true family

6. Protein automated matches [190655] (10 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:196620] [311773] (1 PDB entry)

8. Domain d4x9xa_: 4x9x A: [311774]
   automated match to d3jr7a_
   complexed with edo, ola

Details for d4x9xa_

PDB Entry: 4x9x, 1.2 Å

PDB Description: biochemical roles for conserved residues in the bacterial fatty acid binding protein family

PDB Compounds: (A:) DegV domain-containing protein MW1315

SCOPe Domain Sequences for d4x9xa_:

Sequence, based on SEQRES records:

>d4x9xa_ c.119.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 196620]}
tkqiivtdstsdlskeyleannihviplsltiegasyvdqvditseefinhiendedvkt
sqpaigefisayeelgkdgseiisihlssglsgtyntayqasqmvdanvtvidsksisfg
lgyqiqhlvelvkegvstseivkklnhlreniklfvvigqlnqlikggrisktkglignl
mkikpigtlddgrlelvhnartqnssiqylkkeiaefigdheiksigvahanvieyvdkl
kkvfneafhvnnydinvttpvisahtgqgaiglvvlkk

Sequence, based on observed residues (ATOM records):

>d4x9xa_ c.119.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 196620]}
tkqiivtdstsdlskeyleannihviplsltiegasyvdqvditseefinhiendedvkt
sqpaigefisayeelgkdgseiisihlssglsgtyntayqasqmvdanvtvidsksisfg
lgyqiqhlvelvkegvstseivkklnhlreniklfvvigqlnqlikggriskikpigtld
dgrlelvhnartqnssiqylkkeiaefigdheiksigvahanvieyvdklkkvfneafhv
nnydinvttpvisahtgqgaiglvvlkk

Timeline for d4x9xa_:

• d4x9xa_ is new in SCOPe 2.06-stable
  
• d4x9xa_ appears in SCOPe 2.07
  
• d4x9xa_ appears in the current release, SCOPe 2.08