SCOPe 2.06: Domain d4uezb_: 4uez B:

Lineage for d4uezb_ (4uez B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)

6. Protein automated matches [190397] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188484] (5 PDB entries)

8. Domain d4uezb_: 4uez B: [311760]
   automated match to d2v77a_
   complexed with lff, zn

Details for d4uezb_

PDB Entry: 4uez, 2.29 Å

PDB Description: crystal structure of the human carboxypeptidase a1 in complex with the phosphinic inhibitor acetyl-leu-phe-y( po2ch2)-phe-oh

PDB Compounds: (B:) human carboxypeptidase a1

SCOPe Domain Sequences for d4uezb_:

Sequence; same for both SEQRES and ATOM records:

>d4uezb_ c.56.5.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rstdtfnyatyhtleeiydfldllvaenphlvskiqigntyegrpiyvlkfstggskrpa
iwidtgihsrewvtqasgvwfakkitqdygqdaaftaildtldifleivtnpdgfafths
tnrmwrktrshtagslcigvdpnrnwdagfglsgassnpcsetyhgkfansevevksivd
fvkdhgnikafisihsysqllmypygyktepvpdqdeldqlskaavtalaslygtkfnyg
siikaiyqasgstidwtysqgikysftfelrdtgrygfllpasqiiptaketwlalltim
ehtlnhp

Timeline for d4uezb_:

• d4uezb_ is new in SCOPe 2.06-stable
  
• d4uezb_ appears in SCOPe 2.07
  
• d4uezb_ appears in the current release, SCOPe 2.08