Lineage for d1ftga_ (1ftg A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356722Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1356723Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 1356724Protein Flavodoxin [52220] (9 species)
  7. 1356725Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (8 PDB entries)
  8. 1356737Domain d1ftga_: 1ftg A: [31176]
    apo form
    complexed with so4

Details for d1ftga_

PDB Entry: 1ftg (more details), 2 Å

PDB Description: structure of apoflavodoxin: closure of a tyrosine/tryptophan aromatic gate leads to a compact fold
PDB Compounds: (A:) apoflavodoxin

SCOPe Domain Sequences for d1ftga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ftga_ c.23.5.1 (A:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]}
kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnige
lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl

SCOPe Domain Coordinates for d1ftga_:

Click to download the PDB-style file with coordinates for d1ftga_.
(The format of our PDB-style files is described here.)

Timeline for d1ftga_: