SCOPe 2.07: Domain d4ww2c2: 4ww2 C:184-277

Lineage for d4ww2c2 (4ww2 C:184-277)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (29 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
Domain d4ww2c2: 4ww2 C:184-277 [311757]
Other proteins in same PDB: d4ww2a2, d4ww2c1, d4ww2f_
automated match to d1zt4c1
complexed with jls, nag

Details for d4ww2c2

PDB Entry: 4ww2 (more details), 2.48 Å

PDB Description: crystal structure of human tcr alpha chain-trav21-traj8, beta chain- trbv7-8, antigen-presenting glycoprotein cd1d, and beta-2- microglobulin

PDB Compounds: (C:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d4ww2c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ww2c2 b.1.1.0 (C:184-277) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlyw

SCOPe Domain Coordinates for d4ww2c2:

Click to download the PDB-style file with coordinates for d4ww2c2.
(The format of our PDB-style files is described here.)

Timeline for d4ww2c2: