Lineage for d4ww2c2 (4ww2 C:184-277)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (26 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1304 PDB entries)
  8. 2356891Domain d4ww2c2: 4ww2 C:184-277 [311757]
    Other proteins in same PDB: d4ww2a2, d4ww2c1, d4ww2f_
    automated match to d1zt4c1
    complexed with jls, nag

Details for d4ww2c2

PDB Entry: 4ww2 (more details), 2.48 Å

PDB Description: crystal structure of human tcr alpha chain-trav21-traj8, beta chain- trbv7-8, antigen-presenting glycoprotein cd1d, and beta-2- microglobulin
PDB Compounds: (C:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d4ww2c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ww2c2 b.1.1.0 (C:184-277) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlyw

SCOPe Domain Coordinates for d4ww2c2:

Click to download the PDB-style file with coordinates for d4ww2c2.
(The format of our PDB-style files is described here.)

Timeline for d4ww2c2: