Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species) Class I MHC-related |
Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (13 PDB entries) |
Domain d4ww2c1: 4ww2 C:3-183 [311756] Other proteins in same PDB: d4ww2a1, d4ww2a2, d4ww2b1, d4ww2b2, d4ww2c2, d4ww2f_ automated match to d1zt4c2 complexed with jls, nag |
PDB Entry: 4ww2 (more details), 2.48 Å
SCOPe Domain Sequences for d4ww2c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ww2c1 d.19.1.1 (C:3-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]} vpqrlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqq wetlqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkd ilsfqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselk k
Timeline for d4ww2c1: