Lineage for d4ww2c1 (4ww2 C:3-183)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937553Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2937558Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (15 PDB entries)
  8. 2937562Domain d4ww2c1: 4ww2 C:3-183 [311756]
    Other proteins in same PDB: d4ww2a1, d4ww2a2, d4ww2b1, d4ww2b2, d4ww2c2, d4ww2f_
    automated match to d1zt4c2
    complexed with jls, nag

Details for d4ww2c1

PDB Entry: 4ww2 (more details), 2.48 Å

PDB Description: crystal structure of human tcr alpha chain-trav21-traj8, beta chain- trbv7-8, antigen-presenting glycoprotein cd1d, and beta-2- microglobulin
PDB Compounds: (C:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d4ww2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ww2c1 d.19.1.1 (C:3-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
vpqrlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqq
wetlqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkd
ilsfqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselk
k

SCOPe Domain Coordinates for d4ww2c1:

Click to download the PDB-style file with coordinates for d4ww2c1.
(The format of our PDB-style files is described here.)

Timeline for d4ww2c1: