SCOPe 2.08: Domain d4ww2c1: 4ww2 C:3-183

Lineage for d4ww2c1 (4ww2 C:3-183)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
   Class I MHC-related

7. Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (15 PDB entries)

8. Domain d4ww2c1: 4ww2 C:3-183 [311756]
   Other proteins in same PDB: d4ww2a1, d4ww2a2, d4ww2b1, d4ww2b2, d4ww2c2, d4ww2f_
   automated match to d1zt4c2
   complexed with jls, nag

Details for d4ww2c1

PDB Entry: 4ww2, 2.48 Å

PDB Description: crystal structure of human tcr alpha chain-trav21-traj8, beta chain- trbv7-8, antigen-presenting glycoprotein cd1d, and beta-2- microglobulin

PDB Compounds: (C:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d4ww2c1:

Sequence; same for both SEQRES and ATOM records:

>d4ww2c1 d.19.1.1 (C:3-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
vpqrlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqq
wetlqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkd
ilsfqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselk
k

Timeline for d4ww2c1:

• d4ww2c1 first appeared in SCOPe 2.06
  
• d4ww2c1 appears in SCOPe 2.07