SCOPe 2.08: Domain d4uc4b2: 4uc4 B:976-1026

Lineage for d4uc4b2 (4uc4 B:976-1026)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.0: automated matches [191625] (1 protein)
   not a true family

6. Protein automated matches [191144] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189286] (22 PDB entries)

8. Domain d4uc4b2: 4uc4 B:976-1026 [311752]
   automated match to d2qqra2

Details for d4uc4b2

PDB Entry: 4uc4, 2.56 Å

PDB Description: crystal structure of hybrid tudor domain of human lysine demethylase kdm4b

PDB Compounds: (B:) Lysine-specific demethylase 4B

SCOPe Domain Sequences for d4uc4b2:

Sequence; same for both SEQRES and ATOM records:

>d4uc4b2 b.34.9.0 (B:976-1026) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppsegelvelrwtdgnlykakfissvtshiyqvefedgsqltvkrgdiftl

Timeline for d4uc4b2:

• d4uc4b2 first appeared in SCOPe 2.06
  
• d4uc4b2 appears in SCOPe 2.07