![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
![]() | Family b.34.9.0: automated matches [191625] (1 protein) not a true family |
![]() | Protein automated matches [191144] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189286] (22 PDB entries) |
![]() | Domain d4uc4b1: 4uc4 B:918-975 [311751] automated match to d2qqra1 |
PDB Entry: 4uc4 (more details), 2.56 Å
SCOPe Domain Sequences for d4uc4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uc4b1 b.34.9.0 (B:918-975) automated matches {Human (Homo sapiens) [TaxId: 9606]} avslgqvvitknrnglyyrcrvigaasqtcyevnfddgsysdnlypesitsrdcvqlg
Timeline for d4uc4b1: