Lineage for d1flva_ (1flv A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 982673Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 982674Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 982675Protein Flavodoxin [52220] (9 species)
  7. 982676Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (8 PDB entries)
  8. 982687Domain d1flva_: 1flv A: [31175]
    complexed with fmn

Details for d1flva_

PDB Entry: 1flv (more details), 2 Å

PDB Description: structure of the oxidized long chain flavodoxin from anabaena 7120 at 2 angstroms resolution
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d1flva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1flva_ c.23.5.1 (A:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]}
kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnige
lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl

SCOPe Domain Coordinates for d1flva_:

Click to download the PDB-style file with coordinates for d1flva_.
(The format of our PDB-style files is described here.)

Timeline for d1flva_: