Lineage for d1flv__ (1flv -)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.23: Flavodoxin-like [52171] (17 superfamilies) 
Superfamily c.23.5: Flavoproteins [52218] (3 families) 
Family c.23.5.1: Flavodoxin-related [52219] (3 proteins) Protein Flavodoxin [52220] (7 species) 
Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (5 PDB entries) 
Domain d1flv__: 1flv - [31175]
Details for d1flv__
PDB Entry: 1flv (more details), 2 Å
PDB Description: structure of the oxidized long chain flavodoxin from anabaena 7120 at 2 angstroms resolution
SCOP Domain Sequences for d1flv__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1flv__ c.23.5.1 (-) Flavodoxin {Anabaena, pcc 7119 and 7120}
kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnige
lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
SCOP Domain Coordinates for d1flv__:
Click to download the PDB-style file with coordinates for d1flv__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1flv__:
- d1flv__ first appeared (with stable ids) in SCOP 1.55
- d1flv__ appears in SCOP 1.57
- d1flv__ appears in SCOP 1.61
- d1flv__ appears in the current release, SCOPe 2.08, called d1flva_
View in 3D