Lineage for d1flva_ (1flv A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.5: Flavoproteins [52218] (9 families) 
Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
binds FMN
Protein Flavodoxin [52220] (11 species) 
Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (8 PDB entries) 
Domain d1flva_: 1flv A: [31175]
complexed with fmn
Details for d1flva_
PDB Entry: 1flv (more details), 2 Å
PDB Description: structure of the oxidized long chain flavodoxin from anabaena 7120 at 2 angstroms resolution
PDB Compounds: (A:) flavodoxinSCOPe Domain Sequences for d1flva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1flva_ c.23.5.1 (A:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]}
kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnige
lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
SCOPe Domain Coordinates for d1flva_:
Click to download the PDB-style file with coordinates for d1flva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1flva_:
- d1flva_ first appeared (with stable ids) in SCOP 1.55, called d1flv__
- d1flva_ appears in SCOPe 2.07
View in 3D