SCOPe 2.08: Domain d4xoda1: 4xod A:1-158

Lineage for d4xoda1 (4xod A:1-158)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (11 proteins)

6. Protein automated matches [190569] (9 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [188033] (6 PDB entries)

8. Domain d4xoda1: 4xod A:1-158 [311749]
   automated match to d3zl2a_

Details for d4xoda1

PDB Entry: 4xod, 1.14 Å

PDB Description: crystal structure of a fimh*dsg complex from e.coli f18

PDB Compounds: (A:) FimH PROTEIN

SCOPe Domain Sequences for d4xoda1:

Sequence; same for both SEQRES and ATOM records:

>d4xoda1 b.2.3.2 (A:1-158) automated matches {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapavnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlssfsgtvkyngssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d4xoda1:

• d4xoda1 first appeared in SCOPe 2.06
  
• d4xoda1 appears in SCOPe 2.07