Lineage for d4xjpb_ (4xjp B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2505109Species Mycobacterium tuberculosis [TaxId:1773] [225404] (30 PDB entries)
  8. 2505133Domain d4xjpb_: 4xjp B: [311742]
    automated match to d4cxqa_
    complexed with 41n, edo, peg, plp

Details for d4xjpb_

PDB Entry: 4xjp (more details), 1.6 Å

PDB Description: crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead
PDB Compounds: (B:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase

SCOPe Domain Sequences for d4xjpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xjpb_ c.67.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
ltpeqiiavdgahlwhpyssigreavspvvavaahgawltlirdgqpievldamsswwta
ihghghpaldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvffsdsgsvs
vevaakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhslwtdvlaaqvf
apqvprdydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdlrdicrry
evllifdeiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctadvahtisa
gaagalmhgptfmanplacavsvasvelllgqdwrtritelaagltagldtaralpavtd
vrvcgaigviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsamv
evarlvgsl

SCOPe Domain Coordinates for d4xjpb_:

Click to download the PDB-style file with coordinates for d4xjpb_.
(The format of our PDB-style files is described here.)

Timeline for d4xjpb_: