Lineage for d4xs4a_ (4xs4 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877472Protein Alkyl hydroperoxide reductase AhpC [69516] (5 species)
  7. 2877479Species Salmonella enterica [TaxId:90371] [229124] (7 PDB entries)
  8. 2877505Domain d4xs4a_: 4xs4 A: [311741]
    automated match to d4mabb_
    complexed with k; mutant

Details for d4xs4a_

PDB Entry: 4xs4 (more details), 2.65 Å

PDB Description: salmonella typhimurium ahpc c165s mutant
PDB Compounds: (A:) Alkyl hydroperoxide reductase subunit C

SCOPe Domain Sequences for d4xs4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xs4a_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella enterica [TaxId: 90371]}
slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevspa

SCOPe Domain Coordinates for d4xs4a_:

Click to download the PDB-style file with coordinates for d4xs4a_.
(The format of our PDB-style files is described here.)

Timeline for d4xs4a_: