Lineage for d1dx9d_ (1dx9 D:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 691939Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. 691940Family c.23.5.1: Flavodoxin-related [52219] (5 proteins)
    binds FMN
  6. 691941Protein Flavodoxin [52220] (9 species)
  7. 691942Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (7 PDB entries)
  8. 691949Domain d1dx9d_: 1dx9 D: [31174]
    apo form
    complexed with so4; mutant

Details for d1dx9d_

PDB Entry: 1dx9 (more details), 2.05 Å

PDB Description: w57a apoflavodoxin from anabaena
PDB Compounds: (D:) flavodoxin

SCOP Domain Sequences for d1dx9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dx9d_ c.23.5.1 (D:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]}
kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptanige
lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl

SCOP Domain Coordinates for d1dx9d_:

Click to download the PDB-style file with coordinates for d1dx9d_.
(The format of our PDB-style files is described here.)

Timeline for d1dx9d_: