SCOPe 2.07: Domain d4wuwa2: 4wuw A:110-228

Lineage for d4wuwa2 (4wuw A:110-228)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Surfactant protein, lectin domain [56461] (3 species)

7. Species Norway rat (Rattus norvegicus), SP-A [TaxId:10116] [103352] (15 PDB entries)

8. Domain d4wuwa2: 4wuw A:110-228 [311738]
   Other proteins in same PDB: d4wuwa1
   automated match to d3pbfa2
   complexed with ca, ins; mutant

Details for d4wuwa2

PDB Entry: 4wuw, 2.4 Å

PDB Description: crystal structure of surfactant protein-a ded mutant (e171d/p175e/k203d) complexed with inositol

PDB Compounds: (A:) Pulmonary surfactant-associated protein A

SCOPe Domain Sequences for d4wuwa2:

Sequence; same for both SEQRES and ATOM records:

>d4wuwa2 d.169.1.1 (A:110-228) Surfactant protein, lectin domain {Norway rat (Rattus norvegicus), SP-A [TaxId: 10116]}
smlsvgdkvfstngqsvnfdtikemctraggniavprtpeeneaiasiakkynnyvylgm
iddqtegdfhyldgasvsytnwypgeprgqgkedcvemytdgtwndrgclqyrlavcef

Timeline for d4wuwa2:

• d4wuwa2 first appeared in SCOPe 2.06
  
• d4wuwa2 appears in the current release, SCOPe 2.08