Lineage for d4wuwa2 (4wuw A:110-228)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001752Protein Surfactant protein, lectin domain [56461] (3 species)
  7. 3001787Species Norway rat (Rattus norvegicus), SP-A [TaxId:10116] [103352] (15 PDB entries)
  8. 3001802Domain d4wuwa2: 4wuw A:110-228 [311738]
    Other proteins in same PDB: d4wuwa1
    automated match to d3pbfa2
    complexed with ca, ins; mutant

Details for d4wuwa2

PDB Entry: 4wuw (more details), 2.4 Å

PDB Description: crystal structure of surfactant protein-a ded mutant (e171d/p175e/k203d) complexed with inositol
PDB Compounds: (A:) Pulmonary surfactant-associated protein A

SCOPe Domain Sequences for d4wuwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wuwa2 d.169.1.1 (A:110-228) Surfactant protein, lectin domain {Norway rat (Rattus norvegicus), SP-A [TaxId: 10116]}
smlsvgdkvfstngqsvnfdtikemctraggniavprtpeeneaiasiakkynnyvylgm
iddqtegdfhyldgasvsytnwypgeprgqgkedcvemytdgtwndrgclqyrlavcef

SCOPe Domain Coordinates for d4wuwa2:

Click to download the PDB-style file with coordinates for d4wuwa2.
(The format of our PDB-style files is described here.)

Timeline for d4wuwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4wuwa1