SCOPe 2.08: Domain d4xcel2: 4xce L:107-213

Lineage for d4xcel2 (4xce L:107-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4xcel2: 4xce L:107-213 [311733]
   Other proteins in same PDB: d4xceb1, d4xced1, d4xcel1
   automated match to d1dn0a2

Details for d4xcel2

PDB Entry: 4xce, 2.93 Å

PDB Description: crystal structure of human 4e10 fab crystalized in the presence of phosphatidylcholine (06:0 pc); c2 space group

PDB Compounds: (L:) 4E10 Fab light chain

SCOPe Domain Sequences for d4xcel2:

Sequence; same for both SEQRES and ATOM records:

>d4xcel2 b.1.1.2 (L:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d4xcel2:

• d4xcel2 first appeared in SCOPe 2.06
  
• d4xcel2 appears in SCOPe 2.07