SCOPe 2.07: Domain d4xuga_: 4xug A:

Lineage for d4xuga_ (4xug A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)

6. Protein Trp synthase alpha-subunit [51388] (8 species)

7. Species Salmonella typhimurium [TaxId:90371] [51389] (65 PDB entries)

8. Domain d4xuga_: 4xug A: [311728]
   Other proteins in same PDB: d4xugb_
   automated match to d1k8ya_
   complexed with edo, f9f, nh4, plp

Details for d4xuga_

PDB Entry: 4xug, 1.65 Å

PDB Description: crystal structure of tryptophan synthase from salmonella typhimurium in complex with 2-({[4-(trifluoromethoxy)phenyl]sulfonyl}amino)ethyl dihydrogen phosphate (f9f) inhibitor in the alpha site and ammonium ion in the metal coordination site.

PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d4xuga_:

Sequence; same for both SEQRES and ATOM records:

>d4xuga_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
ieknlaspkqmlaelrsfvsamkaasr

Timeline for d4xuga_:

• d4xuga_ first appeared in SCOPe 2.06
  
• d4xuga_ appears in the current release, SCOPe 2.08