Lineage for d4xxab1 (4xxa B:2-236)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (63 species)
    not a true protein
  7. 2375706Species Vatairea macrocarpa [TaxId:77050] [268912] (6 PDB entries)
  8. 2375714Domain d4xxab1: 4xxa B:2-236 [311724]
    Other proteins in same PDB: d4xxab2
    automated match to d4u36a_
    complexed with 1pe, ca, gol, mn

Details for d4xxab1

PDB Entry: 4xxa (more details), 1.9 Å

PDB Description: crystal structure of a recombinant vatairea macrocarpa seed lectin
PDB Compounds: (B:) seed lectin

SCOPe Domain Sequences for d4xxab1:

Sequence, based on SEQRES records: (download)

>d4xxab1 b.29.1.0 (B:2-236) automated matches {Vatairea macrocarpa [TaxId: 77050]}
sevvsfsftkfnpnpkdiilqgdalvtskgklqltkvkdgkpvdhslgralyaapihiwd
dstdrvasfatsfsfvveapdesktadgiafflappdtqpqkdggflglfndsnksiqtv
avefdtfsntwdpsarhiginvnsiesmkyvkwgwengkvanvyisyeastktltaslty
psnatsyivsanvdlksalpewvrvgfsatsglsrdhvethdvldwsftstlqap

Sequence, based on observed residues (ATOM records): (download)

>d4xxab1 b.29.1.0 (B:2-236) automated matches {Vatairea macrocarpa [TaxId: 77050]}
sevvsfsftkfnpnpkdiilqgdalvtskgklqltkvkdgkpvdhslgralyaapihiwd
dstdrvasfatsfsfvveapdesktadgiafflappdtqpqkdggflglfndsniqtvav
efdtfsntwdpsarhiginvnsiesmkyvkwgwengkvanvyisyeastktltasltyps
natsyivsanvdlksalpewvrvgfsatsglsrdhvethdvldwsftstlqap

SCOPe Domain Coordinates for d4xxab1:

Click to download the PDB-style file with coordinates for d4xxab1.
(The format of our PDB-style files is described here.)

Timeline for d4xxab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xxab2
View in 3D
Domains from other chains:
(mouse over for more information)
d4xxaa_